Clean Eating - March 2015 USA, Czasopisma Kulinarne

[ Pobierz całość w formacie PDF ]
//-->ALL-DAY ENERGY – YOUR 14-DAY MEAL PLANImproving your life one meal at a time.MARCH 2015FRESH,HEALTHY,REAL FOODRECIPESINSANELY EASYWEEKNIGHTMEALS25+SUPERFAST20-MINUTEFAMILYDINNERS!2015100THE 4TH ANNUALCLEAN CHOICEAWARDSCLEANESTPACKAGEDFOODSFRESH TWISTSON TACOS!HOW THE LOW-FAT CRAZEMADE US ALL FATTER1968Eden Co-op began inAnn Arbor, Michigan47 years later -1975100% of EDENgrainand beans certiﬁedorganically grown1988Eden bans anyirradiated foods1993Eden bans allgenetically engineeredfood and GMOderived substances1999BPA free linedcans introducedWe still do justwhat we set outto do:Get the best foodpossible, andmake it availableto as many peopleas we can.©2015 Eden Foods 07763400+ Pure&Purifying Foodsedenfoods.comcontentsClean EatingMARCH 2015P.73MARCH 2015ANR 14-DAY MEAL PLDAY ENERGY – YOUALL-Clean EatingMARCH 2015FRESH,HEALTHY, REAL-FOODRECIPES4TH ANNUALCLEAN CHOICE AWARDS: 100CLEANEST PACKAGED FOODSone meal atImproving your lifea time.FRESH,HEALTHY,REAL FOODRECIPESWEEKNIGHTMEALSINSANELY EASY25+ASTP.5featuresSUPERFAST SUPPERSGeton26under 25 minutes with thesedinner andthe table inquickeasy mealsthat will have your brood begging for seconds!By Julie O’Hara34P.400-CALORIE MEALSEat clean and get lean withthese 10 delicious meals that are each under 400calories.By Marianne WrenP.54SUPERF20-MINUTEFAMILYDINNERS!2648HOW WE GOT THE FAT THING ALL WRONGWith research increasingly showing that saturatedfat is actually good for you, find out why itwas vilified in the first place, and how it canimprove your health.By Jonny Bowden25 EASY WEEKNIGHT MEALSSUPERFAST 20-MINUTE SUPPERS2015100STNECLEAPACKAGEDFOODSNUALANTHE 4THCLEAN CHOICEAWARDScleaneating.com$5.99 USMARCH 2015FRESH TWISTSON TACOS!CRAZEHOW THE LOW-FAT TERMADE US ALL FATy until 03/17Please displa/201554THE 4TH ANNUAL CLEAN CHOICE AWARDSClean Eatingeditors present the 4th Annual CleanChoice Awards in honor of the top 100 cleanest,most earth-friendly grocery-store products. Frompantry staples and protein powders to snacks,dairy and frozen foods, find out which brandsmade the cut this year.P.48On our March 2015 cover we featureKimchi Tacos, Salmon Tacos with Peaches & Fresh Basiland Steak Tacos with Apples & Cilantro, p. 14 and p. 15.Photography by Gibson & Smith, Food styling byMarianne Wren6873GROCERY BAGFive easy-on-your-walletweeknight meals for under $3 a plate.By Dina CheneyYOUR 14-DAYCLEAN EATINGMEAL PLANRecharge your health and whittle your waistlinewhile you’re at it with 2 weeks’ worth of healthy,simple-to-prepare recipes.By Heather BainbridgeMexican Chicken& Cheesy TortelliniSoupp. 29SOUP PHOTO BY GIBSON & SMITHIN EVERY ISSUE:What’s Fresh Online:4/ Recipe Index:5/ Editor’s Letter:8/ Advisory Board & Contributors:10/ Letters:12MARCH 2015Clean Eating1contents88Make these densedouble-chocolatebrownies with creamcheese icing fordessert!travel well80GLOBAL KITCHENA cleaned-up Irishstew that’s packedwith flavorful, heartyveggies and lots ofauthentic flavor.eat smart14BITS ’N’ BITESFood, health andnutrition news youcan use.be inspired82GEAR & GADGETSThe coolest new culinarytools for the home cook.22COMPLEMENTSDiscover 9 brain-boosting nutrientsand foods.5488SWEET TOOTHA St. Paddy’s Daybrownie brimmingwith good luck.24CLASSICS, ONLYCLEANERA creamywhole-grain FettuccineAlfredo that slaysthe competition whenit comes to calories, fatand sodium.We unveil thewinners of the 4thAnnual Clean ChoiceAwards – discoverthe cleanest super-market products in16 categories!weight loss20KICK IT UP A NOTCHNaturopathic doctorRachel Corradetti sharesher insight on detoxesand cleanses.how to84KITCHEN TOOLSWood or plastic?The best cuttingboards for all yourfood-prep needs.3482It's easier than ever to stayslim with these scrumptious400-calorie meals.Brighten up your kitchenwith the coolest culinarygadgets of the moment.100% sun-sweetened sugar cane,grown and harvested in the U. S. A.with the same care you takepreparing food for your family.Find our recipe for Orange Cake with Chocolate Glaze atﬂoridacrystals.com.©2015 Domino Foods, Inc. [ Pobierz całość w formacie PDF ]

Clean Eating - March 2015 USA, Czasopisma Kulinarne

Odnośniki